PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA33G00153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 220aa    MW: 24535.8 Da    PI: 8.4091
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA33G00153genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.17.8e-1380138563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 ++ +r+ +NRe+ArrsR+RK++ ++ L+  + +L++ N++    l   ++++ k ++e+
  AA33G00153  80 RKRKRMLSNRESARRSRLRKQKHVDDLTAQINQLTNDNRQILTSLTVTTQLYMKIQAEN 138
                 57899*********************************998888877777777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1676140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.09478141IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-978121No hitNo description
PfamPF001702.6E-1080133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-1180132No hitNo description
CDDcd147026.49E-2181132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MTPVLSEILL SGLTVKSALR RRTHLVQSFS VVFLYWFYNG ISVILPILMT SSSSTYRSSS  60
SSDAGNLTAA ATTVAVVDER KRKRMLSNRE SARRSRLRKQ KHVDDLTAQI NQLTNDNRQI  120
LTSLTVTTQL YMKIQAENSI LSAQMTELSN RLQSLNEIVE IVTVNGIGFV DQMDGCGFDD  180
RTVGINSNDG YYDDMMNGVT PWGGSVYANQ PIMANDINMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
179100RKRKRMLSNRESARRSRLRKQK
29298RRSRLRK
39299RRSRLRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534852e-46AK353485.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-P17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413979.13e-88PREDICTED: ocs element-binding factor 1-like
RefseqXP_010467622.13e-88PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D3D3501e-108A0A0D3D350_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.3__3423__AT2G18162.14e-84(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.17e-83basic leucine-zipper 2